2.20 Rating by ClearWebStats
rndpolymer.com is 4 years 10 months 2 weeks old. It has a .com as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, rndpolymer.com is SAFE to browse.
Get Custom Widget

Traffic Report of Rndpolymer

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
60
Siteadvisor Rating
View rndpolymer.com site advisor rating Not Applicable

Where is rndpolymer.com server located?

Hosted IP Address:

162.241.148.33 View other site hosted with rndpolymer.com

Hosted Country:

rndpolymer.com hosted country US rndpolymer.com hosted country

Location Latitude:

40.2342

Location Longitude:

-111.6442

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View rndpolymer.com HTML resources

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 4 H2 Headings: 6
H3 Headings: 1 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 8
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 162.241.148.33)

Home - Jennifer Chem Sales

rndpolymer.com favicon - jenniferchemsales.com

View rndpolymer.com Pagerank   rndpolymer.com alexa rank Not Applicable   rndpolymer.com website value $ 8.95

Shri Vishwakarma Safety Training Institute – Safety & Skill Development Institute

rndpolymer.com favicon - shrivishwakarmasafetytraininginstitute.com

View rndpolymer.com Pagerank   rndpolymer.com alexa rank Not Applicable   rndpolymer.com website value $ 8.95

The Shine English Academy – DREAM | LEARN | SPEAK

rndpolymer.com favicon - theshineenglishacademy.com

View rndpolymer.com Pagerank   rndpolymer.com alexa rank Not Applicable   rndpolymer.com website value $ 8.95

Urvashi International Packers and Movers|Movers and Packers Hyderabad

rndpolymer.com favicon - urvashiinternationalpackers.com

Packers and Movers in Hyderabad - Get best price quotes from Packers and Movers in Hyderabad, Movers and Packers in Hyderabad, Packers & Movers in Hyderabad also Get Quote by Hyderabad Packers and Movers from Hyderabad Packers and Movers

View rndpolymer.com Pagerank   rndpolymer.com alexa rank Not Applicable   rndpolymer.com website value $ 8.95

247 Best Pill Pharma – Order Prescription Drugs in our Online shop

rndpolymer.com favicon - 247bestpillpharma.com

View rndpolymer.com Pagerank   rndpolymer.com alexa rank Not Applicable   rndpolymer.com website value $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Thu, 27 Jun 2019 09:10:56 GMT
Server: Apache/2.4.39 (cPanel) OpenSSL/1.0.2r mod_bwlimited/1.4 Phusion_Passenger/5.3.7
X-Powered-By: PHP/5.6.40
Cache-Control: no-cache, private
Upgrade: h2,h2c
Connection: Upgrade
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 7437
Content-Type: text/html; charset=UTF-8

Domain Information for rndpolymer.com

Domain Registrar: GODADDY.COM, LLC rndpolymer.com registrar info
Registration Date: 2019-06-24 4 years 10 months 2 weeks ago
Last Modified: 2019-06-24 4 years 10 months 2 weeks ago

Domain Nameserver Information

Host IP Address Country
ns1.bh-ht-17.webhostbox.net rndpolymer.com name server information 162.241.148.33 rndpolymer.com server is located in United States United States
ns2.bh-ht-17.webhostbox.net rndpolymer.com name server information 162.241.148.33 rndpolymer.com server is located in United States United States

DNS Record Analysis

Host Type TTL Extra
rndpolymer.com A 14399 IP:162.241.148.33
rndpolymer.com NS 21599 Target:ns2.bh-ht-17.webhostbox.net
rndpolymer.com NS 21599 Target:ns1.bh-ht-17.webhostbox.net
rndpolymer.com SOA 21599 MNAME:ns1.bh-ht-17.webhostbox.net
RNAME:cpanel.webhostbox.net
Serial:2019062402
Refresh:3600
Retry:1800
Expire:1209600
rndpolymer.com MX 14399 Target:rndpolymer.com
rndpolymer.com TXT 14399 TXT:v=spf1 +a +mx +ip4:162.241.148.33 ~all

Similarly Ranked Websites to Rndpolymer

Google

rndpolymer.com favicon - google.com

Search the world's information, including webpages, images, videos and more. Google has many special features to help you find exactly what you're looking for.

View rndpolymer.com Pagerank   Alexa rank for rndpolymer.com 1   website value of rndpolymer.com $ 8,833,062,960.00

Google Calendar - Sign in to Access & Edit Your Schedule

rndpolymer.com favicon - calendar.google.com

Access Google Calendar with a Google account (for personal use) or Google Workspace account (for business use).

View rndpolymer.com Pagerank   Alexa rank for rndpolymer.com 1   website value of rndpolymer.com $ 8,833,062,960.00

Gmail

rndpolymer.com favicon - mail.google.com

Gmail is email that’s intuitive, efficient, and useful. 15 GB of storage, less spam, and mobile access.

View rndpolymer.com Pagerank   Alexa rank for rndpolymer.com 1   website value of rndpolymer.com $ 8,833,062,960.00

Android Apps on Google Play

rndpolymer.com favicon - play.google.com

Enjoy millions of the latest Android apps, games, music, movies, TV, books, magazines & more. Anytime, anywhere, across your devices.

View rndpolymer.com Pagerank   Alexa rank for rndpolymer.com 1   website value of rndpolymer.com $ 8,833,062,960.00

Google Chrome - Download the Fast, Secure Browser from Google

rndpolymer.com favicon - chrome.google.com

Get more done with the new Google Chrome. A more simple, secure, and faster web browser than ever, with Google’s smarts built-in. Download now.

View rndpolymer.com Pagerank   Alexa rank for rndpolymer.com 1   website value of rndpolymer.com $ 8,833,062,960.00

Full WHOIS Lookup for rndpolymer.com

Domain Name: RNDPOLYMER.COM
Registry Domain ID: 2405592602_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2019-06-24T08:04:03Z
Creation Date: 2019-06-24T06:42:51Z
Registry Expiry Date: 2020-06-24T06:42:51Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS1.BH-HT-17.WEBHOSTBOX.NET
Name Server: NS2.BH-HT-17.WEBHOSTBOX.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2019-06-27T09:10:25Z